HORDB

ID: hor001899
Uniprot ID: P15438
Protein name: Glucagon-like peptide 2
Gene name: gcg
Organism: Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
Family: Glucagon family
Source: animal
Expression: Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
Disease: NA
Comments: NA
Taxonomy: Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0050896 response to stimulus
GO CC: GO:0005576 extracellular region

Sequence: HADGSFTSDFNKALDIKAAQEFLDWIINTPVKE
Length: 33
Propeptide: HSQGTFTSDYSKYLDSRRAQDFVQWLMNSKRSGGISXXHADGTFTSDMSSYLEEKAAKEFVDWLIKGRPKHADGSFTSDFNKALDIKAAQEFLDWIINTPVKE
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
Mechanism: X's in the sequence were included by homology with other species sequences.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q8K1M5-F1.pdb

hor001899_AF2.pdb

hor001899_ESM.pdb

Mass:	429311	Formula:	C169H254N42O53
Absent amino acids:	CMRY	Common amino acids:	AD
pI:	4.32	Basic residues:	4
Polar residues:	7	Hydrophobic residues:	14
Hydrophobicity:	-34.55	Boman Index:	-5248
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	80
Instability Index:	1766.97	Extinction Coefficient cystines:	5500
Absorbance 280nm:	171.88

PubMed ID: 3260236
Title: Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.